LDHD antibody (Middle Region)

Catalog No. ABIN632075

The Rabbit Polyclonal anti-LDHD antibody is suitable to detect LDHD in samples from Human. It has been validated for WB.

Quick Overview for LDHD antibody (Middle Region) (ABIN632075)

Target: LDHD (Lactate Dehydrogenase D (LDHD))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This LDHD antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-LDHD Antibody

Binding Specificity: Middle Region

Specificity: LDHD antibody was raised against the middle region of LDHD

Purification: Affinity purified

Immunogen: LDHD antibody was raised using the middle region of LDHD corresponding to a region with amino acids LLVNPDDAEELGRVKAFAEQLGRRALALHGTCTGEHGIGMGKRQLLQEEV

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

LDHD Blocking Peptide, (ABIN5614435), is also available for use as a blocking control in assays to test for specificity of this LDHD antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LDHD antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for LDHD

Target: LDHD (Lactate Dehydrogenase D (LDHD))

Alternative Name: LDHD

Background: The protein encoded by this gene belongs to the D-isomer specific 2-hydroxyacid dehydrogenase family. The similar protein in yeast has both D-lactate and D-glycerate dehydrogenase activities. Alternative splicing occurs at this locus and two transcript variants encoding distinct isoforms have been identified.

Molecular Weight: 53 kDa (MW of target protein)

Pathways: Ribonucleoside Biosynthetic Process