ASXL2 antibody

Catalog No. ABIN632099

The Rabbit Polyclonal anti-ASXL2 antibody is suitable to detect ASXL2 in samples from Human. It has been validated for WB.

Quick Overview for ASXL2 antibody (ABIN632099)

Target: ASXL2 (Additional Sex Combs Like 2 (ASXL2))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ASXL2 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-ASXL2 Antibody

Purification: Affinity purified

Immunogen: ASXL2 antibody was raised using a synthetic peptide corresponding to a region with amino acids EEAPVSWEKRPRVTENRQHQQPFQVSPQPFLNRGDRIQVRKVPPLKIPVS

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ASXL2 Blocking Peptide, (ABIN937723), is also available for use as a blocking control in assays to test for specificity of this ASXL2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ASXL2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ASXL2

Target: ASXL2 (Additional Sex Combs Like 2 (ASXL2))

Alternative Name: ASXL2

Background: ASXL2 is a human homolog of the Drosophila asx gene. Drosophila asx is an enhancer of trithorax and polycomb gene that encodes a chromatin protein with dual functions in transcriptional activation and silencing.

Molecular Weight: 154 kDa (MW of target protein)

Pathways: Positive Regulation of fat Cell Differentiation