EPRS antibody (Middle Region)

Catalog No. ABIN632107

This Rabbit Polyclonal antibody specifically detects EPRS in WB. It exhibits reactivity toward Human.

Quick Overview for EPRS antibody (Middle Region) (ABIN632107)

Target: EPRS (Glutamyl-Prolyl-tRNA Synthetase (EPRS))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This EPRS antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-EPRS Antibody

Binding Specificity: Middle Region

Specificity: EPRS antibody was raised against the middle region of EPRS

Purification: Affinity purified

Immunogen: EPRS antibody was raised using the middle region of EPRS corresponding to a region with amino acids GKIVQIPFCGEIDCEDWIKKTTARDQDLEPGAPSMGAKSLCIPFKPLCEL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

EPRS Blocking Peptide, (ABIN938753), is also available for use as a blocking control in assays to test for specificity of this EPRS antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EPRS antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for EPRS

Target: EPRS (Glutamyl-Prolyl-tRNA Synthetase (EPRS))

Alternative Name: EPRS

Background: The protein encoded by this gene is a multifunctional aminoacyl-tRNA synthetase that catalyzes the aminoacylation of glutamic acid and proline tRNA species. Alternative splicing has been observed for this gene, but the full-length nature and biological validity of the variant have not been determined.

Molecular Weight: 170 kDa (MW of target protein)