LETM2 antibody (N-Term)

Catalog No. ABIN632146

This Rabbit Polyclonal antibody specifically detects LETM2 in WB. It exhibits reactivity toward Human.

Quick Overview for LETM2 antibody (N-Term) (ABIN632146)

Target: LETM2 (Leucine Zipper-EF-Hand Containing Transmembrane Protein 2 (LETM2))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This LETM2 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-LETM2 Antibody

Binding Specificity: N-Term

Specificity: LETM2 antibody was raised against the N terminal of LETM2

Purification: Affinity purified

Immunogen: LETM2 antibody was raised using the N terminal of LETM2 corresponding to a region with amino acids KNYESKKYSDPSQPGNTVLHPGTRLIQKLHTSTCWLQEVPGKPQLEQATK

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

LETM2 Blocking Peptide, (ABIN939964), is also available for use as a blocking control in assays to test for specificity of this LETM2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LETM2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for LETM2

Target: LETM2 (Leucine Zipper-EF-Hand Containing Transmembrane Protein 2 (LETM2))

Alternative Name: LETM2

Background: LETM2 contains 1 LETM1 domain. The function of the LETM1 protein remains unknown.

Molecular Weight: 45 kDa (MW of target protein)