Add to Basket
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

Lysophospholipase II (LYPLA2) antibody

Antigen

Lysophospholipase II (LYPLA2)

Synonyms APT-2, DJ886K2.4, LysoII, MGC52664, MGC75683, LYPLA2P1, lypla2, MGC88886, LYPLA2
Clonality Polyclonal
Host
Alternatives

Rabbit

Application
Alternatives Western Blotting (WB)
Catalog no. ABIN632189
Quantity 50 ug  (1 mg/ml)
Price 478.33 $   Plus shipping costs $35.00
Shipping to
Availability Ships within 5 to 7 Business Days

Additional Information

Alternative name LYPLA2
Immunogen LYPLA2 antibody was raised using the N terminal of LYPLA2 corresponding to a region with amino acids MCGNTMSVPLLTDAATVSGAERETAAVIFLHGLGDTGHSWADALSTIRLP
Description Lysophospholipases are enzymes that act on biological membranes to regulate the multifunctional lysophospholipids.Lysophospholipases are enzymes that act on biological membranes to regulate the multifunctional lysophospholipids. There are alternatively spliced transcript variants described for this gene but the full length nature is not known yet.
Molecular Weight 25 kDa (MW of target protein)

Application Details

Concentration 1 mg/ml
Purification Affinity purified
Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of LYPLA2 antibody in PBS
Storage Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C. Avoid repeat freeze-thaw cycles.
Research Area Signaling, Metabolism
Restrictions For Research Use only

Alternatives

Alternatives for antigen "Lysophospholipase II (LYPLA2)", type "Antibodies"
Hosts Mouse (3), Rabbit (1)
Reactivities Human (4)
Applications Western Blotting (WB) (4), Enzyme Immunoassay (EIA) (2), ELISA (1), ELISA (Detection) (1), Immunofluorescence (IF) (1)