VIPAR antibody (Middle Region)

Catalog No. ABIN632204

The Rabbit Polyclonal anti-VIPAR antibody is suitable to detect VIPAR in samples from Human. It has been validated for WB.

Quick Overview for VIPAR antibody (Middle Region) (ABIN632204)

Target: VIPAR (VPS33B Interacting Protein, Apical-Basolateral Polarity Regulator (VIPAR))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This VIPAR antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-VIPAR Antibody

Binding Specificity: Middle Region

Specificity: VIPAR antibody was raised against the middle region of VIPAR

Purification: Affinity purified

Immunogen: VIPAR antibody was raised using the middle region of VIPAR corresponding to a region with amino acids VEDVDTKLNLATKFKCHDVVIDTYRDLKDRQQLLAYRSKVDKGSAEEEKI

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

VIPAR Blocking Peptide, (ABIN5616968), is also available for use as a blocking control in assays to test for specificity of this VIPAR antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of VIPAR antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for VIPAR

Target: VIPAR (VPS33B Interacting Protein, Apical-Basolateral Polarity Regulator (VIPAR))

Alternative Name: VIPAR

Background: This protein is involved in the sorting of lysosomal proteins. Mutations in this gene are associated with ARCS2 (arthrogryposis, renal dysfunction, and cholestasis-2). Alternative splicing results in multiple transcript variants.

Molecular Weight: 57 kDa (MW of target protein)