TNFAIP8L1 antibody (Middle Region)

Catalog No. ABIN632217

The Rabbit Polyclonal anti-TNFAIP8L1 antibody (ABIN632217) specifically detects TNFAIP8L1 in WB. The antibody is reactive with Human samples.

Quick Overview for TNFAIP8L1 antibody (Middle Region) (ABIN632217)

Target: TNFAIP8L1 (Tumor Necrosis Factor, alpha-Induced Protein 8-Like 1 (TNFAIP8L1))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TNFAIP8L1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-TNFAIP8L1 Antibody

Binding Specificity: Middle Region

Specificity: TNFAIP8 L1 antibody was raised against the middle region of TNFAIP8 1

Purification: Affinity purified

Immunogen: TNFAIP8 L1 antibody was raised using the middle region of TNFAIP8 1 corresponding to a region with amino acids AKSHGRINHVFGHLADCDFLAALYGPAEPYRSHLRRICEGLGRMLDEGSL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TNFAIP8L1 Blocking Peptide, , is also available for use as a blocking control in assays to test for specificity of this TNFAIP8L1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TNFAIP0 1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TNFAIP8L1

Target: TNFAIP8L1 (Tumor Necrosis Factor, alpha-Induced Protein 8-Like 1 (TNFAIP8L1))

Alternative Name: TNFAIP8L1

Background: TNFAIP8L1 belongs to the TNFAIP8 family. The exact function of TNFAIP8L is not known.

Molecular Weight: 21 kDa (MW of target protein)