EBI3 antibody (Middle Region)

Catalog No. ABIN632221

This Rabbit Polyclonal antibody specifically detects EBI3 in WB. It exhibits reactivity toward Human.

Quick Overview for EBI3 antibody (Middle Region) (ABIN632221)

Target: EBI3 (IL-27b) (Interleukin-27 subunit beta (IL-27b))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This EBI3 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-EBI3 Antibody

Binding Specificity: Middle Region

Specificity: EBI3 antibody was raised against the middle region of EBI3

Purification: Affinity purified

Immunogen: EBI3 antibody was raised using the middle region of EBI3 corresponding to a region with amino acids TAVHPWGSSSSFVPFITEHIIKPDPPEGVRLSPLAERQLQVQWEPPGSWP

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

EBI3 Blocking Peptide, (ABIN5613292), is also available for use as a blocking control in assays to test for specificity of this EBI3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EBI3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for EBI3

Target: EBI3 (IL-27b) (Interleukin-27 subunit beta (IL-27b))

Alternative Name: EBI3

Background: This gene was identified by its induced expression in B lymphocytes in response Epstein-Barr virus infection. It encodes a secreted glycoprotein belonging to the hematopoietin receptor family, and heterodimerizes with a 28 kDa protein to form interleukin 27 (IL-27). IL-27 regulates T cell and inflammatory responses, in part by activating the Jak/STAT pathway of CD4+ T cells.

Molecular Weight: 23 kDa (MW of target protein)