CSNK1G3 antibody (Middle Region)

Catalog No. ABIN632247

The Rabbit Polyclonal anti-CSNK1G3 antibody (ABIN632247) specifically detects CSNK1G3 in WB. The antibody is reactive with Human, Mouse and Rat samples.

Quick Overview for CSNK1G3 antibody (Middle Region) (ABIN632247)

Target: CSNK1G3 (Casein Kinase 1, gamma 3 (CSNK1G3))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CSNK1G3 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-CSNK1G3 Antibody

Binding Specificity: Middle Region

Specificity: CK1 gamma 3 antibody was raised against the middle region of CSNK1 G3

Purification: Affinity purified

Immunogen: CK1 gamma 3 antibody was raised using the middle region of CSNK1 G3 corresponding to a region with amino acids LEALGHMFMYFLRGSLPWQGLKADTLKERYQKIGDTKRATPIEVLCENFP

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

CK1 gamma 3 Blocking Peptide, (ABIN940261), is also available for use as a blocking control in assays to test for specificity of this CK1 gamma 3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CSNK0 3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CSNK1G3

Target: CSNK1G3 (Casein Kinase 1, gamma 3 (CSNK1G3))

Alternative Name: CK1 gamma 3

Background: Casein kinases are operationally defined by their preferential utilization of acidic proteins such as caseins as substrates. CSNK1G3 can phosphorylate a large number of proteins. It participates in Wnt signaling.

Molecular Weight: 48 kDa (MW of target protein)

Pathways: Hedgehog Signaling