XAF1 antibody (Middle Region)

Catalog No. ABIN632298

The Rabbit Polyclonal anti-XAF1 antibody (ABIN632298) specifically detects XAF1 in WB. The antibody is reactive with Human samples.

Quick Overview for XAF1 antibody (Middle Region) (ABIN632298)

Target: XAF1 (XiAP Associated Factor 1 (XAF1))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This XAF1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-XAF1 Antibody

Binding Specificity: Middle Region

Specificity: XAF1 antibody was raised against the middle region of XAF1

Purification: Affinity purified

Immunogen: XAF1 antibody was raised using the middle region of XAF1 corresponding to a region with amino acids SRTELCQGCGQFIMHRMLAQHRDVCRSEQAQLGKGERISAPEREIYCHYC

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

XAF1 Blocking Peptide, (ABIN5617035), is also available for use as a blocking control in assays to test for specificity of this XAF1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of XAF1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for XAF1

Target: XAF1 (XiAP Associated Factor 1 (XAF1))

Alternative Name: XAF1

Background: X-linked inhibitor of apoptosis is a potent member of the IAP family. All members of this family possess baculoviral IAP (BIR) repeats, cysteine-rich domains of approximately 80 amino acids that bind and inhibit caspases.

Molecular Weight: 34 kDa (MW of target protein)