PDHB antibody

Catalog No. ABIN632317

This Rabbit Polyclonal antibody specifically detects PDHB in WB. It exhibits reactivity toward Human, Mouse and Rat.

Quick Overview for PDHB antibody (ABIN632317)

Target: PDHB (Pyruvate Dehydrogenase beta (PDHB))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PDHB antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-PDHB Antibody

Purification: Affinity purified

Immunogen: PDHB antibody was raised using a synthetic peptide corresponding to a region with amino acids GLWKKYGDKRIIDTPISEMGFAGIAVGAAMAGLRPICEFMTFNFSMQAID

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PDHB Blocking Peptide, (ABIN938817), is also available for use as a blocking control in assays to test for specificity of this PDHB antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PDHB antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PDHB

Target: PDHB (Pyruvate Dehydrogenase beta (PDHB))

Alternative Name: PDHB

Background: The pyruvate dehydrogenase complex catalyzes the overall conversion of pyruvate to acetyl-CoA and CO2. It contains multiple copies of three enzymatic components: pyruvate dehydrogenase (E1), dihydrolipoamide acetyltransferase (E2) and lipoamide dehydrogenase (E3).

Molecular Weight: 39 kDa (MW of target protein)

Pathways: Warburg Effect