serine Dehydratase antibody (Middle Region)

Catalog No. ABIN632335

This Rabbit Polyclonal antibody specifically detects serine Dehydratase in WB. It exhibits reactivity toward Human.

Quick Overview for serine Dehydratase antibody (Middle Region) (ABIN632335)

Target: serine Dehydratase (SDS)

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This serine Dehydratase antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-serine Dehydratase Antibody

Binding Specificity: Middle Region

Specificity: SDS antibody was raised against the middle region of SDS

Purification: Affinity purified

Immunogen: SDS antibody was raised using the middle region of SDS corresponding to a region with amino acids KITSVAKALGVKTVGAQALKLFQEHPIFSEVISDQEAVAAIEKFVDDEKI

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SDS Blocking Peptide, (ABIN939832), is also available for use as a blocking control in assays to test for specificity of this SDS antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SDS antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for serine Dehydratase

Target: serine Dehydratase (SDS)

Alternative Name: SDS

Background: This gene encodes one of three enzymes that are involved in metabolizing serine and glycine. L-serine dehydratase converts L-serine to pyruvate and ammonia and requires pyridoxal phosphate as a cofactor.

Molecular Weight: 34 kDa (MW of target protein)

Pathways: Ribonucleoprotein Complex Subunit Organization, Ribosome Assembly