PDP2 antibody (Middle Region)

Catalog No. ABIN632420

The Rabbit Polyclonal anti-PDP2 antibody is suitable to detect PDP2 in samples from Human. It has been validated for WB.

Quick Overview for PDP2 antibody (Middle Region) (ABIN632420)

Target: PDP2 (Pyruvate Dehyrogenase Phosphatase Catalytic Subunit 2 (PDP2))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PDP2 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-PDP2 Antibody

Binding Specificity: Middle Region

Specificity: PDP2 antibody was raised against the middle region of PDP2

Purification: Affinity purified

Immunogen: PDP2 antibody was raised using the middle region of PDP2 corresponding to a region with amino acids LQRSILERGFNTEALNIYQFTPPHYYTPPYLTAEPEVTYHRLRPQDKFLV

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PDP2 Blocking Peptide, (ABIN5615293), is also available for use as a blocking control in assays to test for specificity of this PDP2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PDP2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PDP2

Target: PDP2 (Pyruvate Dehyrogenase Phosphatase Catalytic Subunit 2 (PDP2))

Alternative Name: PDP2

Background: PDP2 catalyzes the dephosphorylation and concomitant reactivation of the alpha subunit of the E1 component of the pyruvate dehydrogenase complex.

Molecular Weight: 60 kDa (MW of target protein)