BEND7 antibody (Middle Region)

Catalog No. ABIN632454

The Rabbit Polyclonal anti-BEND7 antibody (ABIN632454) specifically detects BEND7 in WB. The antibody is reactive with Human samples.

Quick Overview for BEND7 antibody (Middle Region) (ABIN632454)

Target: BEND7 (BEN Domain Containing 7 (BEND7))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This BEND7 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-BEND7 Antibody

Binding Specificity: Middle Region

Specificity: BEND7 antibody was raised against the middle region of BEND7

Purification: Affinity purified

Immunogen: BEND7 antibody was raised using the middle region of BEND7 corresponding to a region with amino acids LGFGIVLESPSSDPEVQLAEGFDVFMPKSQLDSILSNYTRSGSLLFRKLV

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

BEND7 Blocking Peptide, (ABIN940357), is also available for use as a blocking control in assays to test for specificity of this BEND7 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of BEND7 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for BEND7

Target: BEND7 (BEN Domain Containing 7 (BEND7))

Alternative Name: BEND7

Background: The function of BEND protein is not widely studied, and is yet to be elucidated fully.

Molecular Weight: 51 kDa (MW of target protein)