ACP5 antibody (N-Term)

Catalog No. ABIN632484

The Rabbit Polyclonal anti-ACP5 antibody (ABIN632484) specifically detects ACP5 in WB. The antibody is reactive with Human samples.

Quick Overview for ACP5 antibody (N-Term) (ABIN632484)

Target: ACP5 (Acid Phosphatase 5, Tartrate Resistant (ACP5))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ACP5 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-ACP5 Antibody

Binding Specificity: N-Term

Specificity: ACP5 antibody was raised against the N terminal of ACP5

Purification: Affinity purified

Immunogen: ACP5 antibody was raised using the N terminal of ACP5 corresponding to a region with amino acids DNFYFTGVQDINDKRFQETFEDVFSDRSLRKVPWYVLAGNHDHLGNVSAQ

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ACP5 Blocking Peptide, (ABIN937465), is also available for use as a blocking control in assays to test for specificity of this ACP5 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACP5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ACP5

Target: ACP5 (Acid Phosphatase 5, Tartrate Resistant (ACP5))

Alternative Name: ACP5

Background: This gene encodes an iron containing glycoprotein which catalyzes the conversion of orthophosphoric monoester to alcohol and orthophosphate. It is the most basic of the acid phosphatases and is the only form not inhibited by L(+)-tartrate.

Molecular Weight: 34 kDa (MW of target protein)

Pathways: Transition Metal Ion Homeostasis