AGGF1 antibody (Middle Region)

Catalog No. ABIN632559

The Rabbit Polyclonal anti-AGGF1 antibody (ABIN632559) specifically detects AGGF1 in WB. The antibody is reactive with Human samples.

Quick Overview for AGGF1 antibody (Middle Region) (ABIN632559)

Target: AGGF1 (Angiogenic Factor with G Patch and FHA Domains 1 (AGGF1))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This AGGF1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-AGGF1 Antibody

Binding Specificity: Middle Region

Specificity: AGGF1 antibody was raised against the middle region of AGGF1

Purification: Affinity purified

Immunogen: AGGF1 antibody was raised using the middle region of AGGF1 corresponding to a region with amino acids EYEDEKTLKNPKYKDRAGKRREQVGSEGTFQRDDAPASVHSEITDSNKGR

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

AGGF1 Blocking Peptide, (ABIN938204), is also available for use as a blocking control in assays to test for specificity of this AGGF1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of AGGF1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for AGGF1

Target: AGGF1 (Angiogenic Factor with G Patch and FHA Domains 1 (AGGF1))

Alternative Name: AGGF1

Background: The AGGF1 gene encodes a potent angiogenic factor that contains a forkhead-associated domain and a G-patch domain.

Molecular Weight: 81 kDa (MW of target protein)