Carboxypeptidase X antibody

Catalog No. ABIN632563

This Rabbit Polyclonal antibody specifically detects Carboxypeptidase X in WB. It exhibits reactivity toward Human.

Quick Overview for Carboxypeptidase X antibody (ABIN632563)

Target: Carboxypeptidase X

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Application: Western Blotting (WB)

Product Details

Purification: Affinity purified

Immunogen: Carboxypeptidase X antibody was raised using a synthetic peptide corresponding to a region with amino acids MNDFSYLHTNCFEVTVELSCDKFPHENELPQEWENNKDALLTYLEQVRMG

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Carboxypeptidase X Blocking Peptide, (ABIN5612619), is also available for use as a blocking control in assays to test for specificity of this Carboxypeptidase X antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CPXM1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details

Target: Carboxypeptidase X

Background: This gene likely encodes a member of the carboxypeptidase family of proteins. Cloning of a comparable locus in mouse indicates that the encoded protein contains a discoidin domain and a carboxypeptidase domain, but the protein appears to lack residues necessary for carboxypeptidase activity.

Molecular Weight: 80 kDa (MW of target protein)