CCBE1 antibody (Middle Region)

Catalog No. ABIN632573

The Rabbit Polyclonal anti-CCBE1 antibody is suitable to detect CCBE1 in samples from Human. It has been validated for WB.

Quick Overview for CCBE1 antibody (Middle Region) (ABIN632573)

Target: CCBE1 (Collagen and Calcium Binding EGF Domains 1 (CCBE1))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CCBE1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-CCBE1 Antibody

Binding Specificity: Middle Region

Specificity: CCBE1 antibody was raised against the middle region of CCBE1

Purification: Affinity purified

Immunogen: CCBE1 antibody was raised using the middle region of CCBE1 corresponding to a region with amino acids PMGPSPDLSHIKQGRRGPVGPPGAPGRDGSKGERGAPGPRGSPGPPGSFD

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

CCBE1 Blocking Peptide, (ABIN5612702), is also available for use as a blocking control in assays to test for specificity of this CCBE1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CCBE1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CCBE1

Target: CCBE1 (Collagen and Calcium Binding EGF Domains 1 (CCBE1))

Alternative Name: CCBE1

Background: This gene is thought to function in extracellular matrix remodeling and migration. It is predominantly expressed in the ovary, but down regulated in ovarian cancer cell lines and primary carcinomas, suggesting its role as a tumour suppressor. Mutations in this gene have been associated with Hennekam lymphangiectasia-lymphedema syndrome, a generalized lymphatic dysplasia in humans.

Molecular Weight: 44 kDa (MW of target protein)