Add to Basket
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

Methionine Adenosyltransferase II, alpha (MAT2A) antibody

Antigen

Methionine Adenosyltransferase II, alpha (MAT2A)

Synonyms MATA2, MATII, SAMS2, Sams2, MGC6545, D630045P18Rik, fd12a12, wu:fb95e01, wu:fd12a12, MGC53346, m(2)21ab, MGC76253, MGC79598, DKFZp469P1820
Clonality Polyclonal
Host
Alternatives

Rabbit

Application
Alternatives Western Blotting (WB)
Catalog no. ABIN632627
Quantity 50 ug  (1 mg/ml)
Price 478.33 $   Plus shipping costs $35.00
Shipping to
Availability Ships within 5 to 7 Business Days

Additional Information

Alternative name MAT2A
Immunogen MAT2A antibody was raised using the middle region of MAT2A corresponding to a region with amino acids LLEIVKKNFDLRPGVIVRDLDLKKPIYQRTAAYGHFGRDSFPWEVPKKLK
Description MAT2A catalyzes the formation of S-adenosylmethionine from methionine and ATP.
Molecular Weight 44 kDa (MW of target protein)

Application Details

Concentration 1 mg/ml
Purification Affinity purified
Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of MAT2A antibody in PBS
Storage Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C. Avoid repeat freeze-thaw cycles.
Research Area Signaling, Metabolism, Amino Acids
Restrictions For Research Use only

Alternatives

Alternatives for antigen "Methionine Adenosyltransferase II, alpha (MAT2A)", type "Antibodies"
Hosts Mouse (6), Rabbit (3)
Reactivities Human (7), Cow (Bovine) (1), Monkey (1), Mouse (Murine) (1), Orang-Utan (1), Rat (Rattus) (1)
Applications Western Blotting (WB) (9), ELISA (3), Enzyme Immunoassay (EIA) (3), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (3), Immunohistochemistry (IHC) (1)