REM1 antibody

Catalog No. ABIN632639

The Rabbit Polyclonal anti-REM1 antibody is suitable to detect REM1 in samples from Human. It has been validated for WB.

Quick Overview for REM1 antibody (ABIN632639)

Target: REM1 (RAS (RAD and GEM)-Like GTP-Binding 1 (REM1))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This REM1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-REM1 Antibody

Purification: Affinity purified

Immunogen: REM1 antibody was raised using a synthetic peptide corresponding to a region with amino acids SDSEGSWEALYRVVLLGDPGVGKTSLASLFAGKQERDLHEQLGEDVYERT

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

REM1 Blocking Peptide, (ABIN5615830), is also available for use as a blocking control in assays to test for specificity of this REM1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of REM1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for REM1

Target: REM1 (RAS (RAD and GEM)-Like GTP-Binding 1 (REM1))

Alternative Name: REM1

Background: The protein encoded by this gene is a GTPase and member of the RAS-like GTP-binding protein family. The encoded protein is expressed in endothelial cells, where it promotes reorganization of the actin cytoskeleton and morphological changes in the cells.

Molecular Weight: 33 kDa (MW of target protein)