BDH2 antibody (Middle Region)

Catalog No. ABIN632667

The Rabbit Polyclonal anti-BDH2 antibody (ABIN632667) specifically detects BDH2 in WB. The antibody is reactive with Human samples.

Quick Overview for BDH2 antibody (Middle Region) (ABIN632667)

Target: BDH2 (3-hydroxybutyrate Dehydrogenase, Type 2 (BDH2))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This BDH2 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-BDH2 Antibody

Binding Specificity: Middle Region

Specificity: BDH2 antibody was raised against the middle region of BDH2

Purification: Affinity purified

Immunogen: BDH2 antibody was raised using the middle region of BDH2 corresponding to a region with amino acids NRCVYSTTKAAVIGLTKSVAADFIQQGIRCNCVCPGTVDTPSLQERIQAR

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

BDH2 Blocking Peptide, (ABIN5612309), is also available for use as a blocking control in assays to test for specificity of this BDH2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of BDH2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for BDH2

Target: BDH2 (3-hydroxybutyrate Dehydrogenase, Type 2 (BDH2))

Alternative Name: BDH2

Background: BDH2 is a dehydrogenase that mediates the formation of 2,5-dihydroxybenzoic acid (2,5-DHBA), a siderophore that shares structural similarities with bacterial enterobactin and associates with LCN2, thereby playing a key role in iron homeostasis and transport. It also acts as a 3-hydroxybutyrate dehydrogenase.

Molecular Weight: 27 kDa (MW of target protein)

Pathways: Transition Metal Ion Homeostasis, Monocarboxylic Acid Catabolic Process