MTHFS antibody

Catalog No. ABIN632700

The Rabbit Polyclonal anti-MTHFS antibody (ABIN632700) specifically detects MTHFS in WB. The antibody is reactive with Human, Mouse and Rat samples.

Quick Overview for MTHFS antibody (ABIN632700)

Target: MTHFS (5,10-Methenyltetrahydrofolate Synthetase (5-Formyltetrahydrofolate Cyclo-Ligase) (MTHFS))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This MTHFS antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-MTHFS Antibody

Purification: Affinity purified

Immunogen: MTHFS antibody was raised using a synthetic peptide corresponding to a region with amino acids TSWNIPQPGEGDVREEALSTGGLDLIFMPGLGFDKHGNRLGRGKGYYDAY

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

MTHFS Blocking Peptide, (ABIN5614870), is also available for use as a blocking control in assays to test for specificity of this MTHFS antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MTHFS antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for MTHFS

Target: MTHFS (5,10-Methenyltetrahydrofolate Synthetase (5-Formyltetrahydrofolate Cyclo-Ligase) (MTHFS))

Alternative Name: MTHFS

Background: MTHFS contributes to tetrahydrofolate metabolism. It helps regulate carbon flow through the folate-dependent one-carbon metabolic network that supplies carbon for the biosynthesis of purines, thymidine and amino acids.

Molecular Weight: 23 kDa (MW of target protein)