Add to Basket
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

R3H Domain Containing 2 (R3HDM2) antibody

Antigen

R3H Domain Containing 2 (R3HDM2)

Clonality Polyclonal
Host
Alternatives

Rabbit

Application
Alternatives Western Blotting (WB)
Catalog no. ABIN632805
Quantity 50 ug  (1 mg/ml)
Price 478.33 $   Plus shipping costs $35.00
Shipping to
Availability Ships within 5 to 7 Business Days

Additional Information

Alternative name R3HDM2
Immunogen R3HDM2 antibody was raised using the middle region of R3HDM2 corresponding to a region with amino acids QSTYTVHQGQSGLKHGNRGKRQALKSASTDLGTADVVLGRVLEVTDLPEG
Description R3HDM2 contains 1 R3H domain. The function of R3HDM2 remains unknown.
Molecular Weight 68 kDa (MW of target protein)

Application Details

Concentration 1 mg/ml
Purification Affinity purified
Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of R3HDM2 antibody in PBS
Storage Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C. Avoid repeat freeze-thaw cycles.

Alternatives

Alternatives for antigen "R3H Domain Containing 2 (R3HDM2)", type "Antibodies"
Hosts Mouse (1), Rabbit (1)
Reactivities Human (2)
Applications Western Blotting (WB) (2), ELISA (1), ELISA (Detection) (1), Immunofluorescence (IF) (1)