SMG5 antibody

Catalog No. ABIN632808

The Rabbit Polyclonal anti-SMG5 antibody (ABIN632808) specifically detects SMG5 in WB. The antibody is reactive with Human samples.

Quick Overview for SMG5 antibody (ABIN632808)

Target: SMG5 (Smg-5 Homolog, Nonsense Mediated mRNA Decay Factor (SMG5))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SMG5 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-SMG5 Antibody

Purification: Affinity purified

Immunogen: SMG5 antibody was raised using a synthetic peptide corresponding to a region with amino acids MSQGPPTGESSEPEAKVLHTKRLYRAVVEAVHRLDLILCNKTAYQEVFKP

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SMG5 Blocking Peptide, (ABIN5616302), is also available for use as a blocking control in assays to test for specificity of this SMG5 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SMG5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SMG5

Target: SMG5 (Smg-5 Homolog, Nonsense Mediated mRNA Decay Factor (SMG5))

Alternative Name: SMG5

Background: SMG5 plays a role in nonsense-mediated mRNA decay. SMG5 does not have RNase activity by itself. SMG5 promotes dephosphorylation of RENT1. SMG5 is necessary for TERT activity.

Molecular Weight: 114 kDa (MW of target protein)