HDDC3 antibody (Middle Region)

Catalog No. ABIN632847

The Rabbit Polyclonal anti-HDDC3 antibody (ABIN632847) specifically detects HDDC3 in WB. The antibody is reactive with Human and Mouse samples.

Quick Overview for HDDC3 antibody (Middle Region) (ABIN632847)

Target: HDDC3 (HD Domain Containing 3 (HDDC3))

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This HDDC3 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-HDDC3 Antibody

Binding Specificity: Middle Region

Specificity: HDDC3 antibody was raised against the middle region of HDDC3

Purification: Affinity purified

Immunogen: HDDC3 antibody was raised using the middle region of HDDC3 corresponding to a region with amino acids TDDKTLPKLERKRLQVEQAPHSSPGAKLVKLADKLYNLRDLNRCTPEVKI

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

HDDC3 Blocking Peptide, (ABIN5613976), is also available for use as a blocking control in assays to test for specificity of this HDDC3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HDDC3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for HDDC3

Target: HDDC3 (HD Domain Containing 3 (HDDC3))

Alternative Name: HDDC3

Background: The function of HDDC3 protein is not widely studied, and is yet to be elucidated fully.

Molecular Weight: 16 kDa (MW of target protein)