GADL1 antibody (Middle Region)

Catalog No. ABIN632859

The Rabbit Polyclonal anti-GADL1 antibody (ABIN632859) specifically detects GADL1 in WB. The antibody is reactive with Human samples.

Quick Overview for GADL1 antibody (Middle Region) (ABIN632859)

Target: GADL1 (Glutamate Decarboxylase-Like 1 (GADL1))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This GADL1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-GADL1 Antibody

Binding Specificity: Middle Region

Specificity: GADL1 antibody was raised against the middle region of GADL1

Purification: Affinity purified

Immunogen: GADL1 antibody was raised using the middle region of GADL1 corresponding to a region with amino acids SAECHYSMKKAASFLGIGTENVCFVETDGRGKMIPEELEKQVWQARKEGA

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

GADL1 Blocking Peptide, (ABIN5613703), is also available for use as a blocking control in assays to test for specificity of this GADL1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GADL1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for GADL1

Target: GADL1 (Glutamate Decarboxylase-Like 1 (GADL1))

Alternative Name: GADL1

Background: The function of GADL1 protein is not widely studied, and is yet to be elucidated fully.

Molecular Weight: 38 kDa (MW of target protein)