Add to Basket
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

PBLD antibody

Antigen

PBLD

Clonality Polyclonal
Host
Alternatives

Rabbit

Application
Alternatives Western Blotting (WB)
Catalog no. ABIN632880
Quantity 50 ug  (1 mg/ml)
Price 478.33 $   Plus shipping costs $35.00
Shipping to
Availability Ships within 5 to 7 Business Days

Additional Information

Immunogen PBLD antibody was raised using the N terminal of PBLD corresponding to a region with amino acids KLPIFIADAFTARAFRGNPAAVCLLENELDEDMHQKIAREMNLSETAFIR
Description The function of the PBLD protein has not been widely studied, and is yet to be fully elucidated.
Molecular Weight 31 kDa (MW of target protein)

Application Details

Concentration 1 mg/ml
Purification Affinity purified
Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PBLD antibody in PBS
Storage Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C. Avoid repeat freeze-thaw cycles.

Alternatives

Alternatives for antigen "PBLD", type "Antibodies"
Hosts Mouse (2), Rabbit (1)
Reactivities Human (3), Mouse (Murine) (1), Rat (Rattus) (1)
Applications ELISA (3), Western Blotting (WB) (3)