MAGEB2 antibody (N-Term)

Catalog No. ABIN632892

The Rabbit Polyclonal anti-MAGEB2 antibody (ABIN632892) specifically detects MAGEB2 in WB. The antibody is reactive with Human samples.

Quick Overview for MAGEB2 antibody (N-Term) (ABIN632892)

Target: MAGEB2 (Melanoma Antigen Family B, 2 (MAGEB2))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This MAGEB2 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-MAGEB2 Antibody

Binding Specificity: N-Term

Specificity: MAGEB2 antibody was raised against the N terminal of MAGEB2

Purification: Affinity purified

Immunogen: MAGEB2 antibody was raised using the N terminal of MAGEB2 corresponding to a region with amino acids MPRGQKSKLRAREKRRKARDETRGLNVPQVTEAEEEEAPCCSSSVSGGAA

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

MAGEB2 Blocking Peptide, (ABIN5614635), is also available for use as a blocking control in assays to test for specificity of this MAGEB2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MAGEB2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for MAGEB2

Target: MAGEB2 (Melanoma Antigen Family B, 2 (MAGEB2))

Alternative Name: MAGEB2

Background: This gene is a member of the MAGEB gene family. The members of this family have their entire coding sequences located in the last exon, and the encoded proteins show 50 to 68% sequence identity to each other.

Molecular Weight: 35 kDa (MW of target protein)