TPRKB antibody (Middle Region)

Catalog No. ABIN632917

This Rabbit Polyclonal antibody specifically detects TPRKB in WB. It exhibits reactivity toward Human, Rat and Mouse.

Quick Overview for TPRKB antibody (Middle Region) (ABIN632917)

Target: TPRKB (TP53RK Binding Protein (TPRKB))

Reactivity: Human, Rat, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TPRKB antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-TPRKB Antibody

Binding Specificity: Middle Region

Specificity: TPRKB antibody was raised against the middle region of TPRKB

Purification: Affinity purified

Immunogen: TPRKB antibody was raised using the middle region of TPRKB corresponding to a region with amino acids EGTIDGSLINPTVIVDPFQILVAANKAVHLYKLGKMKTRTLSTEIIFNLS

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TPRKB Blocking Peptide, (ABIN937833), is also available for use as a blocking control in assays to test for specificity of this TPRKB antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TPRKB antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TPRKB

Target: TPRKB (TP53RK Binding Protein (TPRKB))

Alternative Name: TPRKB

Background: The function of TPRKB protein is not widely studied, and is yet to be elucidated fully.

Molecular Weight: 20 kDa (MW of target protein)