PDXP antibody

Catalog No. ABIN632951

The Rabbit Polyclonal anti-PDXP antibody is suitable to detect PDXP in samples from Mouse and Human. It has been validated for WB.

Quick Overview for PDXP antibody (ABIN632951)

Target: PDXP (Pyridoxal (Pyridoxine, Vitamin B6) Phosphatase (PDXP))

Reactivity: Mouse, Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PDXP antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-PDXP Antibody

Purification: Affinity purified

Immunogen: PDXP antibody was raised using a synthetic peptide corresponding to a region with amino acids DPWHPLSDGSRTPGTGSLAAAVETASGRQALVVGKPSPYMFECITENFSI

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PDXP Blocking Peptide, (ABIN937508), is also available for use as a blocking control in assays to test for specificity of this PDXP antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PDXP antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PDXP

Target: PDXP (Pyridoxal (Pyridoxine, Vitamin B6) Phosphatase (PDXP))

Alternative Name: PDXP

Background: Pyridoxal 5-prime-phosphate (PLP) is the active form of vitamin B6 that acts as a coenzyme in maintaining biochemical homeostasis. The preferred degradation route from PLP to 4-pyridoxic acid involves the dephosphorylation of PLP by PDXP.

Molecular Weight: 32 kDa (MW of target protein)