SDR9C7 antibody (Middle Region)

Catalog No. ABIN632990

The Rabbit Polyclonal anti-SDR9C7 antibody is suitable to detect SDR9C7 in samples from Human and Mouse. It has been validated for WB.

Quick Overview for SDR9C7 antibody (Middle Region) (ABIN632990)

Target: SDR9C7 (Short Chain Dehydrogenase/reductase Family 9C, Member 7 (SDR9C7))

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SDR9C7 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-SDR9C7 Antibody

Binding Specificity: Middle Region

Specificity: SDR-O antibody was raised against the middle region of SDR-O

Purification: Affinity purified

Immunogen: SDR-O antibody was raised using the middle region of SDR-O corresponding to a region with amino acids SMEHAIVSRSPRIRYNPGLDAKLLYIPLAKLPTPVTDFILSRYLPRPADS

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SDR-O Blocking Peptide, (ABIN936428), is also available for use as a blocking control in assays to test for specificity of this SDR-O antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SDR-O antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SDR9C7

Target: SDR9C7 (Short Chain Dehydrogenase/reductase Family 9C, Member 7 (SDR9C7))

Alternative Name: SDR-O

Background: SDR-O displays weak conversion of all-trans-retinal to all-trans-retinol in the presence of NADH. Has apparently no steroid dehydrogenase activity.

Molecular Weight: 35 kDa (MW of target protein)