AMN1 antibody

Catalog No. ABIN632997

The Rabbit Polyclonal anti-AMN1 antibody (ABIN632997) specifically detects AMN1 in WB. The antibody is reactive with Human samples.

Quick Overview for AMN1 antibody (ABIN632997)

Target: AMN1 (Antagonist of Mitotic Exit Network 1 Homolog (AMN1))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This AMN1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-AMN1 Antibody

Purification: Affinity purified

Immunogen: AMN1 antibody was raised using a synthetic peptide corresponding to a region with amino acids PRPRRVSQLLDLCLWCFMKNISRYLTDIKPLPPNIKDRLIKIMSMQGQIT

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

AMN1 Blocking Peptide, (ABIN5612048), is also available for use as a blocking control in assays to test for specificity of this AMN1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of AMN1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for AMN1

Target: AMN1 (Antagonist of Mitotic Exit Network 1 Homolog (AMN1))

Alternative Name: AMN1

Background: AMN1 belongs to the AMN1 family. The exact function of AMN1 remains unknown.

Molecular Weight: 28 kDa (MW of target protein)