ERMN antibody (Middle Region)

Catalog No. ABIN633019

This Rabbit Polyclonal antibody specifically detects ERMN in WB. It exhibits reactivity toward Human.

Quick Overview for ERMN antibody (Middle Region) (ABIN633019)

Target: ERMN (Ermin, ERM-Like Protein (ERMN))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ERMN antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-ERMN Antibody

Binding Specificity: Middle Region

Specificity: KIAA1189 antibody was raised against the middle region of Kiaa1189

Purification: Affinity purified

Immunogen: KIAA1189 antibody was raised using the middle region of Kiaa1189 corresponding to a region with amino acids RVIEFKKKHEEVSQFKEEGDASEDSPLSSASSQAVTPDEQPTLGKKSDIS

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

KIAA1189 Blocking Peptide, (ABIN5614333), is also available for use as a blocking control in assays to test for specificity of this KIAA1189 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KIAA1189 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ERMN

Target: ERMN (Ermin, ERM-Like Protein (ERMN))

Alternative Name: KIAA1189

Background: The function of KIAA1189 protein is not widely studied, and is yet to be elucidated fully.

Molecular Weight: 34 kDa (MW of target protein)