GAD antibody

Catalog No. ABIN633036

The Rabbit Polyclonal anti-GAD antibody (ABIN633036) specifically detects GAD in WB. The antibody is reactive with Human samples.

Quick Overview for GAD antibody (ABIN633036)

Target: GAD (GAD1) (Glutamate Decarboxylase 1 (Brain, 67kDa) (GAD1))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This GAD antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-GAD Antibody

Purification: Affinity purified

Immunogen: GAD1 antibody was raised using a synthetic peptide corresponding to a region with amino acids MASSTPSSSATSSNAGADPNTTNLRPTTYDTWCGVAHGCTRKLGLKICGF

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

GAD1 Blocking Peptide, (ABIN5613699), is also available for use as a blocking control in assays to test for specificity of this GAD1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GAD1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for GAD

Target: GAD (GAD1) (Glutamate Decarboxylase 1 (Brain, 67kDa) (GAD1))

Alternative Name: GAD1

Background: This gene encodes one of several forms of glutamic acid decarboxylase, identified as a major autoantigen in insulin-dependent diabetes. The enzyme encoded is responsible for catalyzing the production of gamma-aminobutyric acid from L-glutamic acid. A pathogenic role for this enzyme has been identified in the human pancreas since it has been identified as an autoantigen and an autoreactive T cell target in insulin-dependent diabetes. This gene may also play a role in the stiff man syndrome. Deficiency in this enzyme has been shown to lead to pyridoxine dependency with seizures. Alternative splicing of this gene results in two products, the predominant 67 kDa form and a less-frequent 25 kDa form.

Molecular Weight: 67 kDa (MW of target protein)