MITD1 antibody (Middle Region)

Catalog No. ABIN633079

This Rabbit Polyclonal antibody specifically detects MITD1 in WB. It exhibits reactivity toward Human.

Quick Overview for MITD1 antibody (Middle Region) (ABIN633079)

Target: MITD1 (MIT, Microtubule Interacting and Transport, Domain Containing 1 (MITD1))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This MITD1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-MITD1 Antibody

Binding Specificity: Middle Region

Specificity: MITD1 antibody was raised against the middle region of MITD1

Purification: Affinity purified

Immunogen: MITD1 antibody was raised using the middle region of MITD1 corresponding to a region with amino acids RAENIKKYLDQEKEDGKYHKQIKIEENATGFSYESLFREYLNETVTEVWI

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

MITD1 Blocking Peptide, (ABIN5614776), is also available for use as a blocking control in assays to test for specificity of this MITD1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MITD1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for MITD1

Target: MITD1 (MIT, Microtubule Interacting and Transport, Domain Containing 1 (MITD1))

Alternative Name: MITD1

Background: MITD1 may play a role in endosomal protein transport.

Molecular Weight: 29 kDa (MW of target protein)