ZDHHC21 antibody (Middle Region)

Catalog No. ABIN633123

The Rabbit Polyclonal anti-ZDHHC21 antibody (ABIN633123) specifically detects ZDHHC21 in WB. The antibody is reactive with Human samples.

Quick Overview for ZDHHC21 antibody (Middle Region) (ABIN633123)

Target: ZDHHC21 (Zinc Finger, DHHC-Type Containing 21 (ZDHHC21))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ZDHHC21 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-ZDHHC21 Antibody

Binding Specificity: Middle Region

Specificity: ZDHHC21 antibody was raised against the middle region of ZDHHC21

Purification: Affinity purified

Immunogen: ZDHHC21 antibody was raised using the middle region of ZDHHC21 corresponding to a region with amino acids ELLTCYALMFSFCHYYYFLPLKKRNLDLFVFRHELAIMRLAAFMGITMLV

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ZDHHC21 Blocking Peptide, (ABIN937945), is also available for use as a blocking control in assays to test for specificity of this ZDHHC21 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ZDHHC21 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ZDHHC21

Target: ZDHHC21 (Zinc Finger, DHHC-Type Containing 21 (ZDHHC21))

Alternative Name: ZDHHC21

Background: The function of ZDHHC21 protein is not widely studied, and is yet to be elucidated fully.

Molecular Weight: 31 kDa (MW of target protein)