ANKRD54 antibody (Middle Region)

Catalog No. ABIN633128

The Rabbit Polyclonal anti-ANKRD54 antibody is suitable to detect ANKRD54 in samples from Human. It has been validated for WB.

Quick Overview for ANKRD54 antibody (Middle Region) (ABIN633128)

Target: ANKRD54 (Ankyrin Repeat Domain 54 (ANKRD54))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ANKRD54 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-ANKRD54 Antibody

Binding Specificity: Middle Region

Specificity: ANKRD54 antibody was raised against the middle region of ANKRD54

Purification: Affinity purified

Immunogen: ANKRD54 antibody was raised using the middle region of ANKRD54 corresponding to a region with amino acids EVHALKRLRDSANANDVETVQQLLEDGADPCAADDKGRTALHFASCNGND

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ANKRD54 Blocking Peptide, (ABIN938174), is also available for use as a blocking control in assays to test for specificity of this ANKRD54 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ANKRD54 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ANKRD54

Target: ANKRD54 (Ankyrin Repeat Domain 54 (ANKRD54))

Alternative Name: ANKRD54

Background: ANKRD54 is involved in protein complex binding and protein kinase regulator activity.

Molecular Weight: 32 kDa (MW of target protein)