ANKRD13D antibody (Middle Region)

Catalog No. ABIN633135

The Rabbit Polyclonal anti-ANKRD13D antibody (ABIN633135) specifically detects ANKRD13D in WB. The antibody is reactive with Human samples.

Quick Overview for ANKRD13D antibody (Middle Region) (ABIN633135)

Target: ANKRD13D (Ankyrin Repeat Domain 13 Family, Member D (ANKRD13D))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ANKRD13D antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-ANKRD13D Antibody

Binding Specificity: Middle Region

Specificity: ANKRD13 D antibody was raised against the middle region of ANKRD13

Purification: Affinity purified

Immunogen: ANKRD13 D antibody was raised using the middle region of ANKRD13 corresponding to a region with amino acids ARPPPQATVYEEQLQLERALQESLQLSTEPRGPGSPPRTPPAPGPPSFEE

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ANKRD13D Blocking Peptide, (ABIN936875), is also available for use as a blocking control in assays to test for specificity of this ANKRD13D antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ANKRD10 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ANKRD13D

Target: ANKRD13D (Ankyrin Repeat Domain 13 Family, Member D (ANKRD13D))

Alternative Name: ANKRD13D

Background: The function of Ankyrin protein is not widely studied, and is yet to be elucidated fully.

Molecular Weight: 58 kDa (MW of target protein)