ASZ1 antibody (Middle Region)

Catalog No. ABIN633152

The Rabbit Polyclonal anti-ASZ1 antibody is suitable to detect ASZ1 in samples from Human. It has been validated for WB.

Quick Overview for ASZ1 antibody (Middle Region) (ABIN633152)

Target: ASZ1 (Ankyrin Repeat, SAM and Basic Leucine Zipper Domain Containing 1 (ASZ1))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ASZ1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-ASZ1 Antibody

Binding Specificity: Middle Region

Specificity: ASZ1 antibody was raised against the middle region of ASZ1

Purification: Affinity purified

Immunogen: ASZ1 antibody was raised using the middle region of ASZ1 corresponding to a region with amino acids GKMPSEIAKRNKHHEIFNLLSFTLNPLEGKLQQLTKEDTICKILTTDSDR

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ASZ1 Blocking Peptide, (ABIN938759), is also available for use as a blocking control in assays to test for specificity of this ASZ1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ASZ1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ASZ1

Target: ASZ1 (Ankyrin Repeat, SAM and Basic Leucine Zipper Domain Containing 1 (ASZ1))

Alternative Name: ASZ1

Background: ASZ1 plays a central role during spermatogenesis by repressing transposable elements and prevent their mobilization, which is essential for the germline integrity.

Molecular Weight: 53 kDa (MW of target protein)