Add to Basket
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

ASZ1 antibody

Antigen

ASZ1

Clonality Polyclonal
Host

Rabbit

Application
Western Blotting (WB)
Catalog no. ABIN633152
Quantity 50 ug  (1 mg/ml)
Price 478.33 $   Plus shipping costs $35.00
Shipping to
Availability Ships within 5 to 7 Business Days

Additional Information

Immunogen ASZ1 antibody was raised using the middle region of ASZ1 corresponding to a region with amino acids GKMPSEIAKRNKHHEIFNLLSFTLNPLEGKLQQLTKEDTICKILTTDSDR
Description ASZ1 plays a central role during spermatogenesis by repressing transposable elements and prevent their mobilization, which is essential for the germline integrity.
Molecular Weight 53 kDa (MW of target protein)

Application Details

Concentration 1 mg/ml
Purification Affinity purified
Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ASZ1 antibody in PBS
Storage Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C. Avoid repeat freeze-thaw cycles.
Research Area Organogenesis, Cell Cycle, Metabolism, Tyrosine Kinases