ALDH1A1 antibody

Antigen: ALDH1A1

Clonality: Polyclonal

Host: Rabbit

Application: Western Blotting (WB)

Catalog no.: ABIN633157

Additional Information

Immunogen: ALDH1A1 antibody was raised using the middle region of ALDH1A1 corresponding to a region with amino acids SVERAKKYILGNPLTPGVTQGPQIDKEQYDKILDLIESGKKEGAKLECGG

Description: This protein belongs to the aldehyde dehydrogenases family of proteins. Aldehyde dehydrogenase is the second enzyme of the major oxidative pathway of alcohol metabolism. Two major liver isoforms of this enzyme, cytosolic and mitochondrial, can be distinguished by their electrophoretic mobilities, kinetic properties, and subcellular localizations. Most Caucasians have two major isozymes, while approximately 50% of Orientals have only the cytosolic isozyme, missing the mitochondrial isozyme. A remarkably higher frequency of acute alcohol intoxication among Orientals than among Caucasians could be related to the absence of the mitochondrial isozyme. This gene encodes a cytosolic isoform, which has a high affinity for aldehydes.

Molecular Weight: 55 kDa (MW of target protein)

Application Details

Concentration: 1 mg/ml

Purification: Affinity purified

Buffer: Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ALDH1A1 antibody in PBS

Storage: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C. Avoid repeat freeze-thaw cycles.

Research Area: Stem Cells, Hematopoietic Progenitors, Signaling, Metabolism