ALDH1A1 antibody
| Antigen |
|
| Clonality |
Polyclonal |
|
Host
|
|
|
Application
|
|
| Catalog no. |
ABIN633157 |
| Quantity |
50 ug (1 mg/ml) |
| Price |
478.33 $ Plus shipping costs $35.00
|
| Shipping to |
|
| Availability |
Ships within 5 to 7 Business Days |
|
Immunogen
|
ALDH1A1 antibody was raised using the middle region of ALDH1A1 corresponding to a region with amino acids SVERAKKYILGNPLTPGVTQGPQIDKEQYDKILDLIESGKKEGAKLECGG
|
|
Description
|
This protein belongs to the aldehyde dehydrogenases family of proteins. Aldehyde dehydrogenase is the second enzyme of the major oxidative pathway of alcohol metabolism. Two major liver isoforms of this enzyme, cytosolic and mitochondrial, can be distinguished by their electrophoretic mobilities, kinetic properties, and subcellular localizations. Most Caucasians have two major isozymes, while approximately 50% of Orientals have only the cytosolic isozyme, missing the mitochondrial isozyme. A remarkably higher frequency of acute alcohol intoxication among Orientals than among Caucasians could be related to the absence of the mitochondrial isozyme. This gene encodes a cytosolic isoform, which has a high affinity for aldehydes.
|
|
Molecular Weight
|
55 kDa (MW of target protein)
|
|
Concentration
|
1 mg/ml
|
|
Purification
|
Affinity purified
|
|
Buffer
|
Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ALDH1A1 antibody in PBS
|
|
Storage
|
Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C. Avoid repeat freeze-thaw cycles.
|
|
Research Area
|
Stem Cells, Hematopoietic Progenitors, Signaling, Metabolism
|
Alternatives for antigen "ALDH1A1", type "Antibodies"
|
Hosts
|
Rabbit (23), Mouse (5)
|
|
Reactivities
|
Human (26), Mouse (Murine) (17), Rat (Rattus) (17), Dog (Canine) (16), Rabbit (16), Chicken (15), Cow (Bovine) (15), Horse (Equine) (15), Sheep (Ovine) (15), Yeast (Saccharomyces Cerevisiae) (2)
|
|
Applications
|
Flow Cytometry (FACS) (18), Immunofluorescence (IF) (18), Western Blotting (WB) (11), ELISA (9), Immunoprecipitation (IP) (5), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (4), Immunohistochemistry (IHC) (3), Immunohistochemistry (Formalin-fixed Sections) (IHC (f)) (2), Immunoelectron Microscopy (IEM) (1)
|
|
Conjugates
|
Biotin (2), Alexa Flour 488 (1), Alexa Fluor 350 (1), Alexa Fluor 488 (1), Alexa Fluor 555 (1), Alexa Fluor 647 (1), Cy3 (1), Cy5 (1), Cy5.5 (1), Cy7 (1), FITC (1), Gold (1), HRP (1), PE (1), PE,Cy3 (1), PE,Cy5 (1), PE,Cy5.5 (1), PE,Cy7 (1), RBITC (1)
|