SF3B3 antibody (Middle Region)

Catalog No. ABIN633217

This Rabbit Polyclonal antibody specifically detects SF3B3 in WB. It exhibits reactivity toward Human, Mouse and Rat.

Quick Overview for SF3B3 antibody (Middle Region) (ABIN633217)

Target: SF3B3 (Splicing Factor 3b, Subunit 3, 130kDa (SF3B3))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SF3B3 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-SF3B3 Antibody

Binding Specificity: Middle Region

Specificity: SF3 B3 antibody was raised against the middle region of SF3 3

Purification: Affinity purified

Immunogen: SF3 B3 antibody was raised using the middle region of SF3 3 corresponding to a region with amino acids EHPPLCGRDHLSFRSYYFPVKNVIDGDLCEQFNSMEPNKQKNVSEELDRT

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SF3B3 Blocking Peptide, (ABIN937843), is also available for use as a blocking control in assays to test for specificity of this SF3B3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SF0 3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SF3B3

Target: SF3B3 (Splicing Factor 3b, Subunit 3, 130kDa (SF3B3))

Alternative Name: SF3B3

Background: SF3B3 is subunit 3 of the splicing factor 3b protein complex. Splicing factor 3b, together with splicing factor 3a and a 12S RNA unit, forms the U2 small nuclear ribonucleoproteins complex (U2 snRNP). The splicing factor 3b/3a complex binds pre-mRNA upstream of the intron's branch site in a sequence independent manner and may anchor the U2 snRNP to the pre-mRNA. Splicing factor 3b is also a component of the minor U12-type spliceosome. Subunit 3 has also been identified as a component of the STAGA (SPT3-TAF(II)31-GCN5L acetylase) transcription coactivator-HAT (histone acetyltransferase) complex, and the TFTC (TATA-binding-protein-free TAF(II)-containing complex). These complexes may function in chromatin modification, transcription, splicing, and DNA repair.

Molecular Weight: 135 kDa (MW of target protein)