SF3B3 antibody (Middle Region)

Catalog No. ABIN633219

The Rabbit Polyclonal anti-SF3B3 antibody (ABIN633219) specifically detects SF3B3 in WB. The antibody is reactive with Human samples.

Quick Overview for SF3B3 antibody (Middle Region) (ABIN633219)

Target: SF3B3 (Splicing Factor 3b, Subunit 3, 130kDa (SF3B3))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SF3B3 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-SF3B3 Antibody

Binding Specificity: Middle Region

Specificity: SF3 B3 antibody was raised against the middle region of SF3 3

Purification: Affinity purified

Immunogen: SF3 B3 antibody was raised using the middle region of SF3 3 corresponding to a region with amino acids TVAGADKFGNICVVRLPPNTNDEVDEDPTGNKALWDRGLLNGASQKAEVI

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SF3B3 Blocking Peptide, (ABIN5616090), is also available for use as a blocking control in assays to test for specificity of this SF3B3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SF0 3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SF3B3

Target: SF3B3 (Splicing Factor 3b, Subunit 3, 130kDa (SF3B3))

Alternative Name: SF3B3

Background: SF3B3 is subunit 3 of the splicing factor 3b protein complex. Splicing factor 3b, together with splicing factor 3a and a 12S RNA unit, forms the U2 small nuclear ribonucleoproteins complex (U2 snRNP). The splicing factor 3b/3a complex binds pre-mRNA upstream of the intron's branch site in a sequence independent manner and may anchor the U2 snRNP to the pre-mRNA. Splicing factor 3b is also a component of the minor U12-type spliceosome.

Molecular Weight: 135 kDa (MW of target protein)