SHPRH antibody (N-Term)

Catalog No. ABIN633252

The Rabbit Polyclonal anti-SHPRH antibody (ABIN633252) specifically detects SHPRH in WB. The antibody is reactive with Human samples.

Quick Overview for SHPRH antibody (N-Term) (ABIN633252)

Target: SHPRH (SNF2 Histone Linker PHD RING Helicase, E3 Ubiquitin Protein Ligase (SHPRH))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SHPRH antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-SHPRH Antibody

Binding Specificity: N-Term

Specificity: SHPRH antibody was raised against the N terminal of SHPRH

Purification: Affinity purified

Immunogen: SHPRH antibody was raised using the N terminal of SHPRH corresponding to a region with amino acids SIIPDVLEEDEDDPESEPEGQDIDELYHFVKQTHQQETQSIQVDVQHPAL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SHPRH Blocking Peptide, (ABIN5616134), is also available for use as a blocking control in assays to test for specificity of this SHPRH antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SHPRH antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SHPRH

Target: SHPRH (SNF2 Histone Linker PHD RING Helicase, E3 Ubiquitin Protein Ligase (SHPRH))

Alternative Name: SHPRH

Background: SHPRH is a ubiquitously expressed protein that contains motifs characteristics of several DNA repair proteins, transcription factors, and helicases.

Molecular Weight: 190 kDa (MW of target protein)