IMP3 antibody

Catalog No. ABIN633282

The Rabbit Polyclonal anti-IMP3 antibody (ABIN633282) specifically detects IMP3 in WB. The antibody is reactive with Human, Mouse and Rat samples.

Quick Overview for IMP3 antibody (ABIN633282)

Target: IMP3 (IMP3, U3 Small Nucleolar Ribonucleoprotein (IMP3))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This IMP3 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-IMP3 Antibody

Purification: Affinity purified

Immunogen: IMP3 antibody was raised using a synthetic peptide corresponding to a region with amino acids GHVRVGPDVVTDPAFLVTRSMEDFVTWVDSSKIKRHVLEYNEERDDFDLE

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

IMP3 Blocking Peptide, (ABIN938704), is also available for use as a blocking control in assays to test for specificity of this IMP3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IMP3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for IMP3

Target: IMP3 (IMP3, U3 Small Nucleolar Ribonucleoprotein (IMP3))

Alternative Name: IMP3

Background: This gene encodes the human homolog of the yeast Imp3 protein. The protein localizes to the nucleoli and interacts with the U3 snoRNP complex. The protein contains an S4 domain.

Molecular Weight: 22 kDa (MW of target protein)