KHSRP antibody (Middle Region)

Catalog No. ABIN633384

The Rabbit Polyclonal anti-KHSRP antibody (ABIN633384) specifically detects KHSRP in WB. The antibody is reactive with Human, Mouse and Rat samples.

Quick Overview for KHSRP antibody (Middle Region) (ABIN633384)

Target: KHSRP (KH-Type Splicing Regulatory Protein (KHSRP))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This KHSRP antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-KHSRP Antibody

Binding Specificity: Middle Region

Specificity: KHSRP antibody was raised against the middle region of KHSRP

Purification: Affinity purified

Immunogen: KHSRP antibody was raised using the middle region of KHSRP corresponding to a region with amino acids WEEYYKKQAQVATGGGPGAPPGSQPDYSAAWAEYYRQQAAYYGQTPGPGG

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

KHSRP Blocking Peptide, (ABIN5614319), is also available for use as a blocking control in assays to test for specificity of this KHSRP antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KHSRP antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for KHSRP

Target: KHSRP (KH-Type Splicing Regulatory Protein (KHSRP))

Alternative Name: KHSRP

Background: KHSRP binds to the dendritic targeting element and may play a role in mRNA trafficking. It is part of a ternary complex that binds to the downstream control sequence (DCS) of the pre-mRNA. KHSRP mediates exon inclusion in transcripts that are subject to tissue-specific alternative splicing. It may interact with single-stranded DNA from the far-upstream element (FUSE).

Molecular Weight: 73 kDa (MW of target protein)