APOBEC2 antibody (Middle Region)

Catalog No. ABIN633501

The Rabbit Polyclonal anti-APOBEC2 antibody (ABIN633501) specifically detects APOBEC2 in WB. The antibody is reactive with Human samples.

Quick Overview for APOBEC2 antibody (Middle Region) (ABIN633501)

Target: APOBEC2 (Apolipoprotein B mRNA Editing Enzyme, Catalytic Polypeptide-Like 2 (APOBEC2))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This APOBEC2 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-APOBEC2 Antibody

Binding Specificity: Middle Region

Specificity: ApoBEC2 antibody was raised against the middle region of APOBEC2

Purification: Affinity purified

Immunogen: ApoBEC2 antibody was raised using the middle region of APOBEC2 corresponding to a region with amino acids CKLRIMKPQDFEYVWQNFVEQEEGESKAFQPWEDIQENFLYYEEKLADIL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ApoBEC2 Blocking Peptide, (ABIN937110), is also available for use as a blocking control in assays to test for specificity of this ApoBEC2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of APOBEC2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for APOBEC2

Target: APOBEC2 (Apolipoprotein B mRNA Editing Enzyme, Catalytic Polypeptide-Like 2 (APOBEC2))

Alternative Name: ApoBEC2

Background: APOBEC2 belongs to the cytidine and deoxycytidylate deaminase family. It is probable C to U editing enzyme whose physiological substrate is not yet known. It does not display detectable apoB mRNA editing and has a low intrinsic cytidine deaminase activity.

Molecular Weight: 26 kDa (MW of target protein)