CLIC6 antibody (Middle Region)

Catalog No. ABIN633620

The Rabbit Polyclonal anti-CLIC6 antibody is suitable to detect CLIC6 in samples from Human. It has been validated for WB.

Quick Overview for CLIC6 antibody (Middle Region) (ABIN633620)

Target: CLIC6 (Chloride Intracellular Channel 6 (CLIC6))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CLIC6 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-CLIC6 Antibody

Binding Specificity: Middle Region

Specificity: CLIC6 antibody was raised against the middle region of CLIC6

Purification: Affinity purified

Immunogen: CLIC6 antibody was raised using the middle region of CLIC6 corresponding to a region with amino acids RREDGEASEPRALGQEHDITLFVKAGYDGESIGNCPFSQRLFMILWLKGV

Application Details

Application Notes: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

CLIC6 Blocking Peptide, (ABIN5612930), is also available for use as a blocking control in assays to test for specificity of this CLIC6 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CLIC6 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CLIC6

Target: CLIC6 (Chloride Intracellular Channel 6 (CLIC6))

Alternative Name: CLIC6

Background: CLIon Channel6 encodes a member of the chloride intracellular channel family of proteins. The gene is part of a large triplicated region found on chromosomes 1, 6, and 21.

Molecular Weight: 75 kDa (MW of target protein)