Serotonin Receptor 3B antibody

Catalog No. ABIN633653

The Rabbit Polyclonal anti-Serotonin Receptor 3B antibody is suitable to detect Serotonin Receptor 3B in samples from Human. It has been validated for WB and IHC.

Quick Overview for Serotonin Receptor 3B antibody (ABIN633653)

Target: Serotonin Receptor 3B (HTR3B)

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Serotonin Receptor 3B antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Product Details anti-Serotonin Receptor 3B Antibody

Purification: Affinity purified

Immunogen: Serotonin receptor 3 B antibody was raised using a synthetic peptide corresponding to a region with amino acids PLWACILVAAGILATDTHHPQDSALYHLSKQLLQKYHKEVRPVYNWTKAT

Application Details

Application Notes: WB: 1 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Serotonin receptor 3B Blocking Peptide , , is also available for use as a blocking control in assays to test for specificity of this Serotonin receptor 3B antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HTR0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Serotonin Receptor 3B

Target: Serotonin Receptor 3B (HTR3B)

Alternative Name: Serotonin Receptor 3B

Background: The product of HTR3B belongs to the ligand-gated ion channel receptor superfamily. HTR3B encodes subunit B of the type 3 receptor for 5-hydroxytryptamine (serotonin), a biogenic hormone that functions as a neurotransmitter, a hormone, and a mitogen. This receptor causes fast, depolarizing responses in neurons after activation.

Molecular Weight: 49 kDa (MW of target protein)

Pathways: Synaptic Membrane