KCNN2 antibody (Middle Region)

Catalog No. ABIN633679

This Rabbit Polyclonal antibody specifically detects KCNN2 in WB. It exhibits reactivity toward Human, Rat and Mouse.

Quick Overview for KCNN2 antibody (Middle Region) (ABIN633679)

Target: KCNN2 (Potassium Intermediate/small Conductance Calcium-Activated Channel, Subfamily N, Member 2 (KCNN2))

Reactivity: Human, Rat, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This KCNN2 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-KCNN2 Antibody

Binding Specificity: Middle Region

Specificity: KCNN2 antibody was raised against the middle region of KCNN2

Purification: Affinity purified

Immunogen: KCNN2 antibody was raised using the middle region of KCNN2 corresponding to a region with amino acids KNAAANVLRETWLIYKNTKLVKKIDHAKVRKHQRKFLQAIHQLRSVKMEQ

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

KCNN2 Blocking Peptide, (ABIN939950), is also available for use as a blocking control in assays to test for specificity of this KCNN2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KCNN2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for KCNN2

Target: KCNN2 (Potassium Intermediate/small Conductance Calcium-Activated Channel, Subfamily N, Member 2 (KCNN2))

Alternative Name: KCNN2

Background: KCNN2 is an integral membrane protein that forms a voltage-independent calcium-activated channel with three other calmodulin-binding subunits. This protein is a member of the KCNN family of potassium channel genes. Two transcript variants encoding different isoforms have been found for KCNN2.

Molecular Weight: 26 kDa (MW of target protein)