TRPV4 antibody (Middle Region)

Catalog No. ABIN633742

This Rabbit Polyclonal antibody specifically detects TRPV4 in WB. It exhibits reactivity toward Human.

Quick Overview for TRPV4 antibody (Middle Region) (ABIN633742)

Target: TRPV4 (Transient Receptor Potential Cation Channel, Subfamily V, Member 4 (TRPV4))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TRPV4 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-TRPV4 Antibody

Binding Specificity: Middle Region

Specificity: TRPV4 antibody was raised against the middle region of TRPV4

Purification: Affinity purified

Immunogen: TRPV4 antibody was raised using the middle region of TRPV4 corresponding to a region with amino acids RVDEVNWSHWNQNLGIINEDPGKNETYQYYGFSHTVGRLRRDRWSSVVPR

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TRPV4 Blocking Peptide, (ABIN5616817), is also available for use as a blocking control in assays to test for specificity of this TRPV4 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TRPV4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TRPV4

Target: TRPV4 (Transient Receptor Potential Cation Channel, Subfamily V, Member 4 (TRPV4))

Alternative Name: TRPV4

Background: TRPV4 is a member of the OSM9-like transient receptor potential channel (OTRPC) subfamily in the transient receptor potential (TRP) superfamily of ion channels. TRPV4 is a Ca2+-permeable, nonselective cation channel that is thought to be involved in the regulation of systemic osmotic pressure.

Molecular Weight: 91 kDa (MW of target protein)

Pathways: Hormone Transport, Cell-Cell Junction Organization